Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMLHE Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15472520UL

 View more versions of this product

Catalog No. NBP15472520


Add to cart

Description

Description

TMLHE Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TMLHE
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TMLHE
Synthetic peptides corresponding to TMLHE(trimethyllysine hydroxylase, epsilon) The peptide sequence was selected from the middle region of TMLHE. Peptide sequence PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV.
49 kDa
20ul
DNA Repair, Mismatch Repair
Primary
55217
Western Blot
Western Blot 1:100-1:2000
Q9NVH6
BBOX2TML-alpha-ketoglutarate dioxygenase, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 2, EC 1.14.11.8, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, FLJ10727, TML dioxygenase, TMLD, TMLHTML hydroxylase, trimethyllysine dioxygenase, mitochondrial, trimethyllysine hydroxylase, epsilon, XAP130
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit