Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMLHE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TMLHE |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154725
|
Novus Biologicals
NBP154725 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TMLHE Polyclonal specifically detects TMLHE in Human samples. It is validated for Western Blot.Specifications
TMLHE | |
Polyclonal | |
Rabbit | |
DNA Repair, Mismatch Repair | |
BBOX2TML-alpha-ketoglutarate dioxygenase, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 2, EC 1.14.11.8, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, FLJ10727, TML dioxygenase, TMLD, TMLHTML hydroxylase, trimethyllysine dioxygenase, mitochondrial, trimethyllysine hydroxylase, epsilon, XAP130 | |
TMLHE | |
IgG | |
49 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9NVH6 | |
55217 | |
Synthetic peptides corresponding to TMLHE(trimethyllysine hydroxylase, epsilon) The peptide sequence was selected from the middle region of TMLHE. Peptide sequence PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title