TMPRSS2 Recombinant Protein, Abnova

Human TMPRSS2 full-length ORF recombinant protein with GST-tag at N-terminal.

Manufacturer: Abnova Corporation H00007113P0125

 View more versions of this product

Catalog No. 89-010-925

  Check Availability
Add to Cart

    Specifications

    Cross Reactivity Human
    For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
    Format Solution
    Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
    Molecular Weight 79.86
    Name Human TMPRSS2 Full-length ORF Recombinant Protein with GST-tag at N-terminal
    pH Range 8
    Preparation Method In vitro wheat germ expression system
    Purification Method Glutathione Sepharose 4 Fast Flow
    Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
    Quantity 25μg
    Recombinant Yes
    Source Wheat Germ (in vitro)
    Storage Requirements -80°C

    This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

    • Theoretical MW (kDa): 79.86
    • Preparation method: In vitro wheat germ expression system
    • Purification: Glutathione Sepharose 4 fast flow
    • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

    Sequence: MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

    Best when used within three months from the date of receipt.

    ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit