Abnova™ TNFRSF21 Recombinant Protein

Human TNFRSF21 full-length ORF ( AAH05192.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal

Catalog Number	Mfr. No.	Quantity
89-012-571	Abnova™ H00027242P0110	10 ug
89-012-572	Abnova™ H00027242P0125	25 ug

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. (provided by RefSeq)

• Molecular weight: 39.38
• Preparation method: in vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
• Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Blue

Best use within three months from the date of receipt of this protein

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH05192.1
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 39.38
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: TNFRSF21
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 27242
• Name: TNFRSF21 (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELELHLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT
• Gene Alias: BM-018/DR6/MGC31965
• Gene Symbol: TNFRSF21
• Species: Wheat Germ (in vitro)
• Protein Tag: GST