Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TNNI3K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179279
Description
TNNI3K Polyclonal specifically detects TNNI3K in Mouse samples. It is validated for Western Blot.Specifications
TNNI3K | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
Rabbit | |
Affinity purified | |
RUO | |
51086 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_796040 | |
TNNI3K | |
The immunogen for this antibody is Tnni3k. Peptide sequence NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Equine: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction