Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TNNI3K Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TNNI3K |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17927920
|
Novus Biologicals
NBP17927920UL |
20 μL |
Each for $152.22
|
|
NBP179279
|
Novus Biologicals
NBP179279 |
100 μL |
Each for $436.00
|
|
Description
TNNI3K Polyclonal specifically detects TNNI3K in Mouse samples. It is validated for Western Blot.Specifications
| TNNI3K | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_796040 | |
| 51086 | |
| The immunogen for this antibody is Tnni3k. Peptide sequence NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
| TNNI3K | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title