Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TOB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179476
Description
TOB1 Polyclonal specifically detects TOB1 in Human samples. It is validated for Western Blot.Specifications
TOB1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
APRO6, MGC104792, PIG49, protein Tob1, TOBMGC34446, Transducer of erbB-2 1, transducer of ERBB2, 1, TROB, TROB1 | |
Rabbit | |
38 kDa | |
100 μL | |
Cell Cycle and Replication | |
10140 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_005740 | |
TOB1 | |
Synthetic peptide directed towards the middle region of human TOB1The immunogen for this antibody is TOB1. Peptide sequence DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT. | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: chicken: 85%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Yeast | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction