Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TOB1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TOB1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180225
|
Novus Biologicals
NBP180225 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TOB1 Polyclonal specifically detects TOB1 in Mouse samples. It is validated for Western Blot.Specifications
| TOB1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_033453 | |
| 10140 | |
| Synthetic peptide directed towards the middle region of mouse TOB1. Peptide sequence QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| APRO6, MGC104792, PIG49, protein Tob1, TOBMGC34446, Transducer of erbB-2 1, transducer of ERBB2, 1, TROB, TROB1 | |
| TOB1 | |
| IgG | |
| Protein A purified | |
| 40 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title