Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TOE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31043425UL

 View more versions of this product

Catalog No. NB125770


Add to cart

Description

Description

TOE1 Polyclonal specifically detects TOE1 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

TOE1
Unconjugated
PBS buffer, 2% sucrose
FLJ13949, target of EGR1 protein 1, target of EGR1, member 1 (nuclear)
The immunogen is a synthetic peptide directed towards the middle region of mouse TOE1 (NP_080930). Peptide sequence QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
114034
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit