Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Torsin 2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen Torsin 2A
Immunogen Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16000220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16000220UL
20ul Each for $149.00
Add to cart
 
NBP160002 View Documents Novus BiologicalsSupplier Diversity Partner
NBP160002
100ul Each for $299.00
Add to cart
 
Description

Description

Torsin 2A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Torsin 2A
Rabbit
Polyclonal
Unconjugated
27433
Purified
Western Blot
RUO
Synthetic peptides corresponding to TOR2A(torsin family 2, member A) The peptide sequence was selected from the N terminal of TOR2A. Peptide sequence GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS.
Primary
IgG
FLJ14771, MGC99558, pro salusin, prosalusin, TORP1torsin-2A, Torsin family 2 member A, torsin family 2, member A, Torsin-2A, Torsin-related protein 1
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit