Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TP53I13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17946520UL

 View more versions of this product

Catalog No. NBP17946520


Add to cart

Description

Description

TP53I13 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TP53I13
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TP53I13
Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE.
42 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_612358
DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
90313
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit