Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TP53I13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | TP53I13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179466
|
Novus Biologicals
NBP179466 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TP53I13 Polyclonal specifically detects TP53I13 in Human samples. It is validated for Western Blot.Specifications
| TP53I13 | |
| Polyclonal | |
| Rabbit | |
| NP_612358 | |
| 90313 | |
| Synthetic peptide directed towards the middle region of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence IYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13 | |
| TP53I13 | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title