Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPD52 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TPD52 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156457
|
Novus Biologicals
NBP156457 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TPD52 Polyclonal specifically detects TPD52 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TPD52 | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52 | |
| TPD52 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| P55327 | |
| 7163 | |
| Synthetic peptides corresponding to TPD52(tumor protein D52) The peptide sequence was selected from the middle region of TPD52. Peptide sequence AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title