Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TPPP/p25 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19161420UL

 View more versions of this product

Catalog No. NBP19161420

Add to cart



TPPP/p25 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide corresponding to a region of Mouse. Peptide sequence TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ.
24 kDa
Store at -20C. Avoid freeze-thaw cycles.
Human, Mouse
Western Blot
Western Blot 1:1000
p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein
Protein A purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit