Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP/p25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19161420UL
Description
TPPP/p25 Polyclonal specifically detects TPPP/p25 in Human, Mouse samples. It is validated for Western Blot.Specifications
TPPP/p25 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_878259 | |
TPPP | |
Synthetic peptide corresponding to a region of Mouse. Peptide sequence TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ. | |
Protein A purified | |
RUO | |
11076 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein | |
Rabbit | |
24 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction