Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157640
Description
TPPP3 Polyclonal specifically detects TPPP3 in Human samples. It is validated for Western Blot.Specifications
TPPP3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
brain specific protein, CGI-38, p20, p25gamma, TPPP/p20, tubulin polymerization-promoting protein family member 3 | |
Rabbit | |
Affinity purified | |
RUO | |
51673 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9BW30 | |
TPPP3 | |
Synthetic peptides corresponding to TPPP3(tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the middle region of TPPP3. Peptide sequence PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 92%; Xenopus: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction