Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | TPPP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157640
|
Novus Biologicals
NBP157640 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TPPP3 Polyclonal specifically detects TPPP3 in Human samples. It is validated for Western Blot.Specifications
| TPPP3 | |
| Polyclonal | |
| Rabbit | |
| Q9BW30 | |
| 51673 | |
| Synthetic peptides corresponding to TPPP3(tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the middle region of TPPP3. Peptide sequence PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| brain specific protein, CGI-38, p20, p25gamma, TPPP/p20, tubulin polymerization-promoting protein family member 3 | |
| TPPP3 | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title