Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TPPP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157640
|
Novus Biologicals
NBP157640 |
100 μL |
Each for $436.00
|
|
NBP15764020
|
Novus Biologicals
NBP15764020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
TPPP3 Polyclonal specifically detects TPPP3 in Human samples. It is validated for Western Blot.Specifications
| TPPP3 | |
| Polyclonal | |
| Rabbit | |
| Q9BW30 | |
| 51673 | |
| Synthetic peptides corresponding to TPPP3(tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the middle region of TPPP3. Peptide sequence PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| brain specific protein, CGI-38, p20, p25gamma, TPPP/p20, tubulin polymerization-promoting protein family member 3 | |
| TPPP3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title