Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89


Antigen TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Applications Western Blot, ChIP assay
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart
View Documents
Novus Biologicals
100 μg
Each for $352.89
Add to cart


TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal antibody specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Human samples. It is validated for Western Blot, ChIP assay


TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Western Blot, ChIP assay
avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
The immunogen is a synthetic peptide directed towards the N terminal region of human TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_000452). Peptide sequence MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Cancer, Neuroscience
PBS buffer, 2% sucrose
Affinity purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit