Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257253

Catalog No. NBP257253


Add to cart

Description

Description

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal antibody specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

TR beta 1/NR1A2/Thyroid Hormone Receptor beta
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
Rabbit
IgG
100 ul
Cancer, Neuroscience
Primary
7068
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
THRB
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only