Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRADD Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310118100UL
Description
TRADD Polyclonal specifically detects TRADD in Human samples. It is validated for Western Blot.Specifications
TRADD | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MGC11078, TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein, tumor necrosis factor receptor type 1 associated death domain protein, tumor necrosis factor receptor type 1-associated DEATH domain protein, tumor necrosis factor receptor-1-associated protein | |
The immunogen is a synthetic peptide directed towards the middle region of human TRADD (NP_001310481.1). Peptide sequence QPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEY | |
100 μg | |
Apoptosis, Cancer, Death Receptor Signaling Pathway, Tumor Suppressors | |
8717 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction