Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRADD Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen TRADD
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125137
View Documents
Novus Biologicals
NBP310118100UL
100 μg
Each for $352.89
Add to cart
 
NB125138
View Documents
Novus Biologicals
NBP31011825UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

TRADD Polyclonal antibody specifically detects TRADD in Human samples. It is validated for Western Blot
Specifications

Specifications

TRADD
Western Blot
Purified
RUO
Human
MGC11078, TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein, tumor necrosis factor receptor type 1 associated death domain protein, tumor necrosis factor receptor type 1-associated DEATH domain protein, tumor necrosis factor receptor-1-associated protein
The immunogen is a synthetic peptide directed towards the middle region of human TRADD (NP_001310481.1). Peptide sequence QPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEY
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Apoptosis, Cancer, Death Receptor Signaling Pathway, Tumor Suppressors
PBS buffer, 2% sucrose
8717
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit