Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

TRAFD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180008

 View more versions of this product

Catalog No. NBP180008



Description

Description

TRAFD1 Polyclonal antibody specifically detects TRAFD1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

TRAFD1
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
TRAFD1
Synthetic peptide directed towards the C terminal of human TRAFD1. Peptide sequence TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG.
65 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Horse: 86%; Mouse: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_006691
FLN29FLN29 gene product, Protein FLN29, TRAF-type zinc finger domain containing 1, TRAF-type zinc finger domain-containing protein 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10906
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit