Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAFD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TRAFD1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180008
|
Novus Biologicals
NBP180008 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TRAFD1 Polyclonal specifically detects TRAFD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TRAFD1 | |
Polyclonal | |
Rabbit | |
NP_006691 | |
10906 | |
Synthetic peptide directed towards the C terminal of human TRAFD1. Peptide sequence TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
FLN29FLN29 gene product, Protein FLN29, TRAF-type zinc finger domain containing 1, TRAF-type zinc finger domain-containing protein 1 | |
TRAFD1 | |
IgG | |
65 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title