Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAM1L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TRAM1L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160111
|
Novus Biologicals
NBP160111 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TRAM1L1 Polyclonal specifically detects TRAM1L1 in Human samples. It is validated for Western Blot.Specifications
TRAM1L1 | |
Polyclonal | |
Rabbit | |
Q8N609 | |
133022 | |
Synthetic peptides corresponding to TRAM1L1(translocation associated membrane protein 1-like 1) The peptide sequence was selected from the middle region of TRAM1L1. Peptide sequence LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC26568, translocating chain-associated membrane protein 1-like 1, translocation associated membrane protein 1-like 1 | |
TRAM1L1 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title