Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Transcobalamin II Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Transcobalamin II
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP174220
View Documents
Novus Biologicals
NBP174220
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Transcobalamin II Polyclonal specifically detects Transcobalamin II in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

Transcobalamin II
Western Blot
Unconjugated
RUO
O88968
6948
Synthetic peptides corresponding to the N terminal of Tcn2. Immunizing peptide sequence PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
D22S676, D22S750, macrocytic anemia, TC, TC-2, TC2II, TCII, transcobalamin II; macrocytic anemia, transcobalamin IITC II, transcobalamin-2, vitamin B12-binding protein 2
TCN2
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit