Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Transcobalamin II Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Transcobalamin II |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174220
|
Novus Biologicals
NBP174220 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Transcobalamin II Polyclonal specifically detects Transcobalamin II in Mouse samples. It is validated for Western Blot.Specifications
| Transcobalamin II | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O88968 | |
| 6948 | |
| Synthetic peptides corresponding to the N terminal of Tcn2. Immunizing peptide sequence PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| D22S676, D22S750, macrocytic anemia, TC, TC-2, TC2II, TCII, transcobalamin II; macrocytic anemia, transcobalamin IITC II, transcobalamin-2, vitamin B12-binding protein 2 | |
| TCN2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title