Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Transglutaminase 7/TGM7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Transglutaminase 7/TGM7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154404
|
Novus Biologicals
NBP154404 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Transglutaminase 7/TGM7 Polyclonal specifically detects Transglutaminase 7/TGM7 in Human samples. It is validated for Western Blot.Specifications
| Transglutaminase 7/TGM7 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| Q96PF1 | |
| 116179 | |
| Synthetic peptides corresponding to TGM7(transglutaminase 7) The peptide sequence was selected from the C terminal of TGM7. Peptide sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| protein-glutamine gamma-glutamyltransferase Z, TG(Z), TGase Z, TGase-7, TGMZEC 2.3.2.13, TGZ, transglutaminase 7, Transglutaminase Z, transglutaminase-7 | |
| TGM7 | |
| IgG | |
| Affinity Purified | |
| 80 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title