Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TREML2/TLT-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TREML2/TLT-2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170737
|
Novus Biologicals
NBP170737 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TREML2/TLT-2 Polyclonal specifically detects TREML2/TLT-2 in Human samples. It is validated for Western Blot.Specifications
| TREML2/TLT-2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 79865 | |
| Synthetic peptides corresponding to TREML2(triggering receptor expressed on myeloid cells-like 2) The peptide sequence was selected from the middle region of TREML2. Peptide sequence TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf76, dJ238O23.1, FLJ13693, MGC149715, MGC149716, TLT2, TLT-2, trem-like transcript 2 protein, triggering receptor expressed on myeloid cells-like 2, triggering receptor expressed on myeloid cells-like protein 2, UNQ6268/PRO20473 | |
| TREML2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title