Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

TRIM14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen TRIM14
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125594
View Documents
Novus Biologicals
NBP31034625UL
25 μg
Each for $106.19
N/A
NB125593
View Documents
Novus Biologicals
NBP310346100UL
100 μg
Each for $352.89
N/A
Description

Description

TRIM14 Polyclonal antibody specifically detects TRIM14 in Human samples. It is validated for Western Blot
Specifications

Specifications

TRIM14
Western Blot
Purified
RUO
Human
KIAA0129tripartite motif-containing 14, tripartite motif containing 14, tripartite motif protein TRIM14, tripartite motif-containing protein 14
The immunogen is a synthetic peptide directed towards the middle region of human TRIM14 (NP_150090). Peptide sequence SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Stem Cell Markers
PBS buffer, 2% sucrose
9830
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit