Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18004420UL

 View more versions of this product

Catalog No. NBP18004420


Add to cart

Description

Description

TRIM17 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TRIM17
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
TRIM17
Synthetic peptide directed towards the C terminal of human TRIM17. Peptide sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS.
54 kDa
20ul
Zinc Finger
Primary
51127
Western Blot
Western Blot 1:1000
NP_001020111
E3 ubiquitin-protein ligase TRIM17, EC 6.3.2.-, RBCCRNF16terf, RING finger protein 16, RING finger protein terf, TERF, Testis RING finger protein, tripartite motif containing 17, tripartite motif-containing 17, Tripartite motif-containing protein 17
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit