Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180044
Description
TRIM17 Polyclonal specifically detects TRIM17 in Human samples. It is validated for Western Blot.Specifications
TRIM17 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
E3 ubiquitin-protein ligase TRIM17, EC 6.3.2.-, RBCCRNF16terf, RING finger protein 16, RING finger protein terf, TERF, Testis RING finger protein, tripartite motif containing 17, tripartite motif-containing 17, Tripartite motif-containing protein 17 | |
Rabbit | |
54 kDa | |
100 μL | |
Zinc Finger | |
51127 | |
Human | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_001020111 | |
TRIM17 | |
Synthetic peptide directed towards the C terminal of human TRIM17. Peptide sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS. | |
Protein A purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction