TRIM17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180044

Catalog No. NBP180044

Description

TRIM17 Polyclonal specifically detects TRIM17 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRIM17
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase TRIM17, EC 6.3.2.-, RBCCRNF16terf, RING finger protein 16, RING finger protein terf, TERF, Testis RING finger protein, tripartite motif containing 17, tripartite motif-containing 17, Tripartite motif-containing protein 17
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 51127
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001020111
• Gene Symbols: TRIM17
• Immunogen: Synthetic peptide directed towards the C terminal of human TRIM17. Peptide sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG