Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM3/BERP Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179699

 View more versions of this product

Catalog No. NBP179699


Add to cart

Description

Description

TRIM3/BERP Polyclonal antibody specifically detects TRIM3/BERP in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

TRIM3/BERP
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TRIM3
The immunogen for this antibody is Trim3. Peptide sequence FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA.
81 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rat: 100%; Equine: 92%; Mouse: 92%; Pig: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:1000
NP_061368
BERPRING finger protein 97, Brain-expressed RING finger protein, HAC1, RING finger protein 22, RNF22brain expressed ring finger, RNF97FLJ16135, tripartite motif containing 3, tripartite motif protein TRIM3, tripartite motif-containing 3, tripartite motif-containing protein 3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10612
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit