TRIM3/BERP Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179699

Catalog No. NBP179699

Description

TRIM3/BERP Polyclonal specifically detects TRIM3/BERP in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: TRIM3/BERP
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_061368
• Gene Symbols: TRIM3
• Immunogen: The immunogen for this antibody is Trim3. Peptide sequence FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10612
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BERPRING finger protein 97, Brain-expressed RING finger protein, HAC1, RING finger protein 22, RNF22brain expressed ring finger, RNF97FLJ16135, tripartite motif containing 3, tripartite motif protein TRIM3, tripartite motif-containing 3, tripartite motif-containing protein 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 81 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rat: 100%; Equine: 92%; Mouse: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG