Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM34 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TRIM34
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18005020
View Documents
Novus Biologicals
NBP18005020UL
20 μL
Each for $152.22
Add to cart
 
NBP180050
View Documents
Novus Biologicals
NBP180050
100 μL
Each for $436.00
Add to cart
 
Description

Description

TRIM34 Polyclonal specifically detects TRIM34 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TRIM34
Polyclonal
Rabbit
Zinc Finger
EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34
TRIM34
IgG
Affinity Purified
31 kDa
Western Blot
Unconjugated
RUO
NP_569074
53840
Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence SMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit