Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM49 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TRIM49 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155061
|
Novus Biologicals
NBP155061 |
100 μL |
Each of 1 for $436.00
|
|
Description
TRIM49 Polyclonal specifically detects TRIM49 in Human samples. It is validated for Western Blot.Specifications
TRIM49 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
Q9NS80 | |
57093 | |
Synthetic peptides corresponding to TRIM49(tripartite motif-containing 49) The peptide sequence was selected from the N terminal of TRIM49. Peptide sequence RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
RING finger protein 18TRIM49L2, RNF18testis-specific RING Finger protein, Testis-specific RING-finger protein, tripartite motif containing 49, tripartite motif-containing 49, tripartite motif-containing protein 49 | |
TRIM49 | |
IgG | |
Affinity Purified | |
53 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title