Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. TRIM49 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TRIM49 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $378.35

Specifications

Antigen TRIM49
Immunogen Synthetic peptides corresponding to TRIM49(tripartite motif-containing 49) The peptide sequence was selected from the N terminal of TRIM49. Peptide sequence RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1550620
View Documents
View Product Certificates
Novus Biologicals
NBP15506120UL 		20ul Each for $152.22
Add to cart
 
NBP155061
View Documents
View Product Certificates
Novus Biologicals
NBP155061 		100 ul Each for $378.35
Add to cart
 
Description

Description

TRIM49 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TRIM49
Rabbit
Polyclonal
Unconjugated
57093
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to TRIM49(tripartite motif-containing 49) The peptide sequence was selected from the N terminal of TRIM49. Peptide sequence RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF.
Primary
IgG
RING finger protein 18TRIM49L2, RNF18testis-specific RING Finger protein, Testis-specific RING-finger protein, tripartite motif containing 49, tripartite motif-containing 49, tripartite motif-containing protein 49
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit