Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM58 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17970620UL

 View more versions of this product

Catalog No. NBP17970620


Add to cart

Description

Description

TRIM58 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TRIM58
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TRIM58
Synthetic peptide directed towards the middle region of human TRIM58The immunogen for this antibody is TRIM58. Peptide sequence FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH.
55 kDa
20ul
Zinc Finger
Primary
25893
Western Blot
Western Blot 1:1000
NP_056246
BIA2, DKFZp434C091, Protein BIA2, tripartite motif containing 58, tripartite motif-containing 58, tripartite motif-containing protein 58
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit