Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM58 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$157.00 - $482.50
Specifications
Antigen | TRIM58 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17970620
|
Novus Biologicals
NBP17970620UL |
20 μL |
Each for $157.00
|
|
|||||
NBP179706
|
Novus Biologicals
NBP179706 |
100 μL |
Each for $482.50
|
|
|||||
Description
TRIM58 Polyclonal specifically detects TRIM58 in Human samples. It is validated for Western Blot.Specifications
TRIM58 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
NP_056246 | |
25893 | |
Synthetic peptide directed towards the middle region of human TRIM58The immunogen for this antibody is TRIM58. Peptide sequence FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
BIA2, DKFZp434C091, Protein BIA2, tripartite motif containing 58, tripartite motif-containing 58, tripartite motif-containing protein 58 | |
TRIM58 | |
IgG | |
55 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title