Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRIM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31052025UL

 View more versions of this product

Catalog No. NB125942


Add to cart

Description

Description

TRIM8 Polyclonal specifically detects TRIM8 in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

TRIM8
Unconjugated
PBS buffer, 2% sucrose
EC 6.3.2.-, GERP, GERPRING finger protein 27glioblastoma expressed ring finger protein, Glioblastoma-expressed RING finger protein, RNF27probable E3 ubiquitin-protein ligase TRIM8, tripartite motif containing 8, tripartite motif protein TRIM8, tripartite motif-containing 8, Tripartite motif-containing protein 8
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM8 (NP_112174). Peptide sequence RGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIVEKFNALHVEK
25 μg
Zinc Finger
Primary
81603
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit