Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Triosephosphate isomerase Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15288120UL
Description
Triosephosphate isomerase Polyclonal specifically detects Triosephosphate isomerase in Human, Mouse samples. It is validated for Western Blot.Specifications
Triosephosphate isomerase | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P60174 | |
TPI1 | |
Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 5.3.1.1, MGC88108, TIM, TPI, triosephosphate isomerase, Triose-phosphate isomerase, triosephosphate isomerase 1 | |
Rabbit | |
27 kDa | |
20 μL | |
Stem Cell Markers | |
7167 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title