Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Triosephosphate isomerase Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15288120UL

 View more versions of this product

Catalog No. NBP1528820


Add to cart

Description

Description

Triosephosphate isomerase Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

Triosephosphate isomerase
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TPI1
Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID.
27 kDa
20ul
Stem Cell Markers
Primary
7167
Western Blot
Western Blot 1:100-1:2000
P60174
EC 5.3.1.1, MGC88108, TIM, TPI, triosephosphate isomerase, Triose-phosphate isomerase, triosephosphate isomerase 1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human, Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit