Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Triosephosphate isomerase Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Triosephosphate isomerase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1528820
|
Novus Biologicals
NBP15288120UL |
20 μL |
Each for $152.22
|
|
NBP152881
|
Novus Biologicals
NBP152881 |
100 μL |
Each for $436.00
|
|
Description
Triosephosphate isomerase Polyclonal specifically detects Triosephosphate isomerase in Human, Mouse samples. It is validated for Western Blot.Specifications
Triosephosphate isomerase | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
P60174 | |
7167 | |
Synthetic peptides corresponding to TPI1(triosephosphate isomerase 1) The peptide sequence was selected from the N terminal of TPI1. Peptide sequence MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 5.3.1.1, MGC88108, TIM, TPI, triosephosphate isomerase, Triose-phosphate isomerase, triosephosphate isomerase 1 | |
TPI1 | |
IgG | |
Affinity Purified | |
27 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title