Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRMT1L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TRMT1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180371
|
Novus Biologicals
NBP180371 |
100 μL |
Each for $436.00
|
|
NBP1803720
|
Novus Biologicals
NBP18037120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
TRMT1L Polyclonal specifically detects TRMT1L in Human samples. It is validated for Western Blot.Specifications
| TRMT1L | |
| Polyclonal | |
| Rabbit | |
| NP_112196 | |
| 81627 | |
| Synthetic peptide directed towards the middle region of human C1orf25. Peptide sequence QFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C1orf25MST070, chromosome 1 open reading frame 25, MGC25112, MGC57134, TRM1 tRNA methyltransferase 1-like, TRM1LbG120K12.3, TRM1-like protein | |
| TRMT1L | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title