TRMT2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155171

Catalog No. NBP155171

Description

TRMT2B Polyclonal specifically detects TRMT2B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRMT2B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96GJ1
• Gene Symbols: TRMT2B
• Immunogen: Synthetic peptides corresponding to CXORF34 The peptide sequence was selected from the middle region of CXORF34. Peptide sequence GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79979
• Target Species: Human, Mouse, Porcine, Canine, Equine, Rabbit
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome X open reading frame 34, CXorf34, dJ341D10.3, EC 2.1.1.35, FLJ12687, TRM2 homolog, TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae), tRNA (uracil-5-)-methyltransferase homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG