Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRMT2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TRMT2B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155171
View Documents
Novus Biologicals
NBP155171
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TRMT2B Polyclonal specifically detects TRMT2B in Human samples. It is validated for Western Blot.
Specifications

Specifications

TRMT2B
Polyclonal
Purified
RUO
Q96GJ1
79979
Synthetic peptides corresponding to CXORF34 The peptide sequence was selected from the middle region of CXORF34. Peptide sequence GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome X open reading frame 34, CXorf34, dJ341D10.3, EC 2.1.1.35, FLJ12687, TRM2 homolog, TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae), tRNA (uracil-5-)-methyltransferase homolog
TRMT2B
IgG
Protein A purified
56 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit