Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRMT2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TRMT2B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155171
|
Novus Biologicals
NBP155171 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TRMT2B Polyclonal specifically detects TRMT2B in Human samples. It is validated for Western Blot.Specifications
TRMT2B | |
Polyclonal | |
Purified | |
RUO | |
chromosome X open reading frame 34, CXorf34, dJ341D10.3, EC 2.1.1.35, FLJ12687, TRM2 homolog, TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae), tRNA (uracil-5-)-methyltransferase homolog | |
TRMT2B | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q96GJ1 | |
79979 | |
Synthetic peptides corresponding to CXORF34 The peptide sequence was selected from the middle region of CXORF34. Peptide sequence GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA. | |
Primary | |
56 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title