Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRPV5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309268100UL
Description
TRPV5 Polyclonal specifically detects TRPV5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| TRPV5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Calcium transport protein 2, calcium transporter 2, ECaC, ECaC1, ECAC1CaT2, Epithelial calcium channel 1CAT2, Osm-9-like TRP channel 3, OTRPC3, transient receptor potential cation channel subfamily V member 5, transient receptor potential cation channel, subfamily V, member 5, TrpV5 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5 (NP_062815). Peptide sequence MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 56302 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction