Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRSPAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TRSPAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157446
|
Novus Biologicals
NBP157446 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TRSPAP1 Polyclonal specifically detects TRSPAP1 in Human samples. It is validated for Western Blot.Specifications
| TRSPAP1 | |
| Polyclonal | |
| Rabbit | |
| Q9NX07 | |
| 54952 | |
| Synthetic peptides corresponding to TRSPAP1(tRNA selenocysteine associated protein 1) The peptide sequence was selected from the N terminal of TRSPAP1. Peptide sequence PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ20503, PRO1902, SECp43, SECP43RP4-669K10.4, tRNA selenocysteine 1 associated protein 1, tRNA selenocysteine 1-associated protein 1, tRNA selenocysteine associated protein (SECP43), tRNA selenocysteine associated protein 1, tRNA selenocysteine-associated protein 1, TRSPAP1 | |
| TRNAU1AP | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title