Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRSPAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TRSPAP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157446
View Documents
Novus Biologicals
NBP157446
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TRSPAP1 Polyclonal specifically detects TRSPAP1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TRSPAP1
Polyclonal
Rabbit
Q9NX07
54952
Synthetic peptides corresponding to TRSPAP1(tRNA selenocysteine associated protein 1) The peptide sequence was selected from the N terminal of TRSPAP1. Peptide sequence PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
FLJ20503, PRO1902, SECp43, SECP43RP4-669K10.4, tRNA selenocysteine 1 associated protein 1, tRNA selenocysteine 1-associated protein 1, tRNA selenocysteine associated protein (SECP43), tRNA selenocysteine associated protein 1, tRNA selenocysteine-associated protein 1, TRSPAP1
TRNAU1AP
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit