Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TRUB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TRUB2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15651520
View Documents
Novus Biologicals
NBP15651520UL
20 μL
Each for $152.22
Add to cart
 
NBP156515
View Documents
Novus Biologicals
NBP156515
100 μL
Each for $436.00
Add to cart
 
Description

Description

TRUB2 Polyclonal specifically detects TRUB2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TRUB2
Polyclonal
Purified
RUO
O95900
26995
Synthetic peptides corresponding to TRUB2(TruB pseudouridine (psi) synthase homolog 2 (E. coli)) The peptide sequence was selected from the middle region of TRUB2. Peptide sequence MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CLONE24922, EC 5.4.99.-, probable tRNA pseudouridine synthase 2, RP11-339B21.1, TruB pseudouridine (psi) synthase homolog 2 (E. coli)
TRUB2
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit