Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRUB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TRUB2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15651520
|
Novus Biologicals
NBP15651520UL |
20 μL |
Each for $152.22
|
|
NBP156515
|
Novus Biologicals
NBP156515 |
100 μL |
Each for $436.00
|
|
Description
TRUB2 Polyclonal specifically detects TRUB2 in Human samples. It is validated for Western Blot.Specifications
| TRUB2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| O95900 | |
| 26995 | |
| Synthetic peptides corresponding to TRUB2(TruB pseudouridine (psi) synthase homolog 2 (E. coli)) The peptide sequence was selected from the middle region of TRUB2. Peptide sequence MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CLONE24922, EC 5.4.99.-, probable tRNA pseudouridine synthase 2, RP11-339B21.1, TruB pseudouridine (psi) synthase homolog 2 (E. coli) | |
| TRUB2 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title