Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRXR3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198287
Description
TRXR3 Polyclonal specifically detects TRXR3 in Human samples. It is validated for Western Blot.Specifications
| TRXR3 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| NP_001166984 | |
| TXNRD3 | |
| The immunogen for this antibody is TRXR3 - middle region. Peptide sequence NHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ. | |
| Affinity Purified | |
| RUO | |
| 114112 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| TGR, thioredoxin reductase 3, TR2, TRXR3 | |
| Rabbit | |
| 66 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 86%; Porcine: 86%; Equine: 86%; Rat: 79%; Zebrafish: 79%; Guinea pig: 77%, Rabbit: 85%. | |
| Human, Mouse, Rat, Porcine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title