Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSG-9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TSG-9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170738
|
Novus Biologicals
NBP170738 |
100 μL |
Each for $436.00
|
|
NBP17073820
|
Novus Biologicals
NBP17073820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
TSG-9 Polyclonal specifically detects TSG-9 in Human samples. It is validated for Western Blot.Specifications
| TSG-9 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 286319 | |
| Synthetic peptides corresponding to TUSC1(tumor suppressor candidate 1) The peptide sequence was selected from the middle region of TUSC1. Peptide sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| TSG9, tumor suppressor candidate 1 | |
| TUSC1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title