Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSGA10IP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TSGA10IP |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124701
|
Novus Biologicals
NBP309900100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
TSGA10IP Polyclonal specifically detects TSGA10IP in Human samples. It is validated for Western Blot.Specifications
TSGA10IP | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
FAM161C, FLJ32880, MGC120465, MGC120466, MGC120468, testis specific, 10 interacting protein, testis-specific protein 10-interacting protein, Tsga10-interacting protein | |
The immunogen is a synthetic peptide directed towards the middle region of Human TSGA10IP. Peptide sequence GHQALPMPSSFSQRQSRRKSTANLPEAHGCCWKTEAQNLKARQQLGAWGG | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
254187 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title