Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TSPAN32/TSSC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	TSPAN32/TSSC6
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP162646 View Documents View Product Certificates	Novus Biologicals NBP162646	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TSPAN32/TSSC6 Polyclonal specifically detects TSPAN32/TSSC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	TSPAN32/TSSC6
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q96QS1-2
Gene ID (Entrez)	10077
Immunogen	Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR.
Primary or Secondary	Primary
Molecular Weight of Antigen	31 kDa

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	ART1, FLJ17158, FLJ97586, MGC22455, pan-hematopoietic expression, PHEMXPHMX, Protein Phemx, tetraspanin 32, tetraspanin-32, tspan-32, TSSC6pan-hematopoietic expression protein, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6
Gene Symbols	TSPAN32
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TSPAN32/TSSC6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents