Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15534920UL
Description
TSR1 Polyclonal specifically detects TSR1 in Human samples. It is validated for Western Blot.Specifications
TSR1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q2NL82 | |
TSR1 | |
Synthetic peptides corresponding to TSR1(TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV. | |
Affinity Purified | |
RUO | |
55720 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ10534, KIAA1401, MGC131829, pre-rRNA-processing protein TSR1 homolog, TSR1, 20S rRNA accumulation, homolog (S. cerevisiae), TSR1, 20S rRNA accumulation, homolog (yeast) | |
Rabbit | |
92 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title