Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TTC16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155177
|
Novus Biologicals
NBP155177 |
100 μL |
Each for $436.00
|
|
NBP15517720
|
Novus Biologicals
NBP15517720UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
TTC16 Polyclonal specifically detects TTC16 in Human samples. It is validated for Western Blot.Specifications
| TTC16 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8NEE8 | |
| 158248 | |
| Synthetic peptides corresponding to TTC16(tetratricopeptide repeat domain 16) The peptide sequence was selected from the C terminal of TTC16. Peptide sequence RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ32780, tetratricopeptide repeat domain 16, tetratricopeptide repeat protein 16, TPR repeat protein 16 | |
| TTC16 | |
| IgG | |
| Affinity Purified | |
| 98 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title