Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TTC16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155177
|
Novus Biologicals
NBP155177 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TTC16 Polyclonal specifically detects TTC16 in Human samples. It is validated for Western Blot.Specifications
TTC16 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ32780, tetratricopeptide repeat domain 16, tetratricopeptide repeat protein 16, TPR repeat protein 16 | |
TTC16 | |
IgG | |
98 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8NEE8 | |
158248 | |
Synthetic peptides corresponding to TTC16(tetratricopeptide repeat domain 16) The peptide sequence was selected from the C terminal of TTC16. Peptide sequence RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title